DMCZmysel
Guest
DMCZmysel

Why would Jim hesitate to sing the theme to Horizon? Why does race of the singer matters? Isn’t that stupid and maybe racist?

GMBigKev
Guest

He said outright he was worried that there may be some cultural connotation to it that his butchering of the song would be deemed offensive.

Jak
Guest
Jak

Get TotalBiscuit and his crew from CoOpPodcast on the Podquistion…

Dallium
Guest
Dallium

Oh please no. I don’t know why, but I cannot stand Jessie Cox. I have nothing against him personally, but I can’t tolerate anything he’s in.

erni79
Guest
“Those who would give up essential Liberty, to purchase a little temporary Safety, deserve neither Liberty nor Safety.”, not my favorite person in our world’s history, but he is correct when he is correct. 🙂 To quote someone of the oppsite political spectrum: “Es gibt freilich Kommunisten, welche es sich bequem machen und die persönliche Freiheit, die nach ihrer Meinung der Harmonie im Wege steht, leugnen und aufheben wollen; wir aber haben keine Lust, die Gleichheit mit der Freiheit zu erkaufen.“ (Friedrich Engels, Kommunistische Zeitschrift, September 1847) “There are of course communists, who got cozy and who want to deny… Read more »
Wellsy487
Guest
Wellsy487

To answer Laura’s question about having time to play all these games, I get maybe an hour a day on the computer if I’m lucky.
I’m looking at getting Nioh and Horizon Zero Dawn in the next couple of months. I think that people may have a bit more money this time of the year compared to November.

Marcusss
Guest
Marcusss

While you pronounce Automata pretty much right…. the way you pronounced Gestalt was skin crawlingly bad, Jim. 🙂

Otherhand
Guest
Otherhand

You don’t say “automaton” as “or-tom-AY-ton”. You say “or-tom-uh-ton”. “Automata” is the plural, and therefore it’s pronounced “or-TOM-uh-ta”. I will set fire to the teeth of anyone who says otherwise. YOUR TEETH, SIR.

Sam
Guest
Sam
Jim, I say if you have more than five games that you qualify as “outstanding” than just give out more than five awards at the end of the year. Why do we treat five as the magic number? Consider this: One year it’s a particularly good year, and you have 6 games that are outstanding, but you only give out awards to the top 5. The next year is a rubbish year for games, and you really have to scrounge to find 5 games worthy of an award. And it happens that none of the five games you pick are… Read more »
twigcollins
Guest
twigcollins

Jim, mate. You’re a lovely, lovely boy.

Please leave the singing to Gavin.

Sperium3000
Guest
Sperium3000

Hey Jim, when you played Binding of Isaac on the PC, did you use the keyboard or controllers? Because maybe your thing on the Switch is just not being used to playing that game in a controller. That’s something that also happened to me, but I got used to it.

If you always used a controller even on the PC, then I don’t know. I haven’t touched the Switch yet.

Allan Weallans
Guest
Allan Weallans

I know he played it a lot on PS3 (or was it PS4?) so I don’t think that’s the issue.

InfamousDS
Guest
InfamousDS

He played it extensively on PS4 before moving to PC because it had more updates and content. He also played it on 3DS a lot.

Allan Weallans
Guest
Allan Weallans

Huh, I guess I went and bought that there Nier: Atomic Kitten after listening today. And here was me thinking the next game I bought would be Persona 5. Are you sure you’re not taking an unethical commission or something?

Ember Assington
Guest
Ember Assington

Has anyone made a “Jim Cucking Sterling, Son!” joke yet?

CaptainDustTree
Guest
CaptainDustTree

I believe it’s James Cucking Stanton.

Terriosaurus Hex
Guest
Terriosaurus Hex

Hey I’m still here bro. Yeah, okay that probably isn’t much better than a brain parasite acknowledging thanks for the juicy real estate by whispering sweet nothings into your auditory association area whilst nibbling lovingly on your juicy cerebral cortex, but at least I’m not parroting alternative facts at the same time.

All you peeps seem to be able to play all the cool new games, and I’ve only just gotten round to Life is Strange. I don’t even know why I do this to myself.

darksteel6
Guest
darksteel6

I often tend to play older games I missed out on, I just recently finished the Division and i’m looking forward to playing through all the Spider-Man games.

Nitrium
Guest
Nitrium

Nothing wrong with playing older games. You a) get them MUCH cheaper, b) they have had all the bugs ironed out in patches + all the DLC at once in GOTY editions, c) if you’re on PC there are likely many community mods to make the game look/play better, and d) there is a now huge number of online resources to help you out if you get stuck etc.

Spurious K
Guest
Spurious K
I’m finding it weird currently, I could theoretically play new games if they’re on PC at least; I don’t own any/can’t justify the cost of any of the consoles so all these exclusives are passing me by, and the stuff that’s been coming out on PC as well just simply isn’t to my taste in games. But yeah, am also just playing catch-up with waiting on sales otherwise. Well, sales combined with sufficient patching and mods where required. Have had a lot of fun with Battle Brothers and Everspace, which whilst they’re in the dreaded early access phase, they’re practically… Read more »
crowmanhunter
Guest
crowmanhunter

I’ve been waiting since wings of liberty to get Starcraft 2. Gotta content myself with oldschool Broodwar because that’s all my computer and my budget can handle at the moment.

No shame in playing to your budget.

darksteel6
Guest
darksteel6
For Honor sold really well last month, but it’s current playerbase is pretty lackluster, that game is having an even bigger drop in players then Evolve did, so things are not looking good for that game in the long term. I like shooty soldier games and I still like Andromeda, I thought the intro was fine. I have to say Wildlands is my favorite open-world game of the year so far. Part of the reason why I think it sold so well is because it’s been a fairly long time since the last Ghost Recon game came out. I quite… Read more »
SilentPony
Guest
SilentPony

I want it on record you’ll never get rid of me Jim. You can give up on video games entirely and just talk about wet dreams involving Triple H, Stoya, Prowl and Bluestreak, a 3 gallon tub of blackberry flavored lube and buttermilk biscuits and I’ll still be here, complaining you’re going on too much about Dark Souls.

McJohnstable
Guest
McJohnstable

more instrumental musical intermissions by gavin, please 😛

Jamesworkshop
Guest
Jamesworkshop

Joycon sounds like a convention, rather than a piece of consumer hardware.

Leah
Guest
Leah

To clarify, I think it’s just a song. It’s not some native American chant or anything.

Sebastian Bo
Guest
Sebastian Bo

Jim said he gave Nier a 10 but, the review he wrote has a 9/10, which i did find weird with all the praise he gave it

Neto
Guest
Neto

Nioh, not Nier.

Anton
Guest
Anton

No, it’s spelled Nior

InfamousDS
Guest
InfamousDS

I thought it was spelled LANoire.

sillyskeleton
Guest
sillyskeleton

Don’t be silly. No one thinks LA Noire was a 10.

Sebastian Bo
Guest
Sebastian Bo

Ah right, those 2 sound so similar

George
Guest
George

Sorry for the extra comment…

I forgot to mention: Laura, I just got into the Gerudo town in Breath of the Wild and yeah…I am very surprised (in a very positive and good way) that that entire sequence got into a Nintendo game. To me it was good natured humour and it didn’t feel like, “haha look at those people,” it felt more like, “lets all laugh together.” But that’s just my interpretation.

InfamousDS
Guest
InfamousDS

It’s one of the best segments in a Zelda game, by far. And not because of any kind of political reasons (that helps) but because it was well thought-out and well orchestrated as well as a great way to subvert expectations when compared to OoT’s brute force approach.
Everyone being so chill or accepting is just icing on top. Especially that one guy who actually falls in love with you, completely unrelated to the quest itself.

George
Guest
George
WARNING SPOILERS ALERT!!!!! sfhkjshfkjhsfkjdshfkshfkhsdksdjhfsdjfhskfhsdfhsdkjfhskdjfhksdhdskjhfdskfhdskfhdskfjdhsfksdhflkshdlakjlsyuewroewpriewoifusd jnkdsjfhadkfhjdask lfakjfh cjknkadjscnkjdsnckldsjnfdjksfhdusfhdskfhdsjfhadslkfhadskljfhasdkljfhadskjhdsafkjlsdahfdsalkjfh cowjekdsfjbhdshfjbvdjk ckjvn aklvdlvnkjadnfkadfbkjbvklnvmldkvkldshvdkfjhvdfjhv dfjvhdkvloerutirturtyutyurtyuryruyspksczjcvbxbmnbmnvn gsadjhgsajgcmodsitmrtnkrngkfdghdhvnctvytfstyfatysdrasrdystadrsaytdrsaydtrsaytdrvsaytdrasytdbcdniodfijvfdmkdgbbmvclkbovcbjvoclbmfdhlgfkhjgfkljhgfklhjgflkhjgfljoaisdyasgchdgsvcxbjkweryiueyeiwutgeyudsfgvdzvxzbnvcxznbcbxzbncvxzgchxzvhjkcxvkcxnb jzhxvgxzchjjvgnxzjc,vhdslfusdfhdsjkbfdskjfhxzkjnvcxzkjvhcxkjnvnzcjvhbnkcjxhvgjkxzchvgbcxzhvxzjhvbxzjvxgbzkjvxgcvxzh I liked the part when you first got the female clothing. When you have the dialog choice in how you’re reacting to the that person. “Squint suspiciously” and you have the choice to say “because I think you’re beautiful.” And just the little part with the wind that blows up the face covering and they both just kind of shrug. It was sweet and kid friendly. It was like if Nintendo wanted to make a statement on Trans/Gay/Lesbian people and gender that’s how they would do it.… Read more »
Anton
Guest
Anton

On the subject of “getting into things” – I’m still really surprised so many people just got into the Witcher series in Witcher 2 or 3, without playing 1 or reading the books. Don’t get me wrong, 2 and 3 are great, but I feel that most of my appreciation for those games comes from having a background on the universe before starting.

Leah
Guest
Leah

Witcher 1 did not age that well.

GloatingSwine
Guest
GloatingSwine

Witcher 1 was based on the Neverwinter Nights engine, which has aged spectacularly badly.

Anton
Guest
Anton

Weirdly enough, I re-played it only a year or so ago and had a lot of fun despite the jank.

Anton
Guest
Anton

Yeah, that’s true. If any game deserves a remaster with revamped gameplay it’s Witcher 1.

Still, I would imagine that without having Witcher 1, the start of Witcher 2 must be confusing and uninvolved to first-time players. Same goes for starting Witcher 3 without playing the previous games.

mrhair
Guest
mrhair

I actually had more problem with the narrative then the gameplay. Like, you’re trying to track these bandits down, but the kid I’m supposed to be avenging had maybe five lines of dialogue, and I don’t even know what these stolen “Witcher secrets” are. It got better later on, but trying to stay invested during the first few chapters was a trial.

Anton
Guest
Anton

I think that the “stolen witcher secrets” were actually a way bigger deal than the kid. Leo was nice and all, but Geralt really only went to get his mutagens back XD

thatdamnrat
Guest
thatdamnrat

I’m going to have to disagree with you there, Witcher 1 was pretty lackluster even when it was released.

gasmaskangel
Guest
gasmaskangel
The game does a fairly good job at explaining its world and set up without needing knowledge of the previous games/books for context. Yes, plot elements from them do come up but they don’t dominate the story or dialogue… which is a good thing considering that Witcher 1 has some of the jankiest control issues I’ve ever encountered, and I personally have a low tolerance for the “everything is pure misery all the time, for everyone, forever and also everyone is a rapist” brand of dark fantasy that the books seem to draw from*. *Note: that’s purely from hearsay when… Read more »
Uldi
Guest
Uldi
I didn’t have any real trouble at all getting into Witcher 2. I could tell that there was a great deal of lore behind everything. Of course, I spent a lot of time actually reading the lore bits the game gives you. Eventually I looked up specific information on the Witcher wiki. What initially put me off of Witcher 2 was the damn tutorial tacked on at the beginning; the one where Geralt wakes up on the shore of a river somewhere. The combat tutorial just confused and frustrated the hell out of me. When the actual game started, I… Read more »
George
Guest
George

Also, Gavin I agree, the word, “Joycon” is repulsive. It’s a wretch worthy vile insult to the English language.

Akito Soma
Guest
Akito Soma

CHILIDOGS! I’M SONIC! I swear, that was the funniest bit in any Podquisition ever, last week included! I’d pay you, Jim, to have you say that again all day. By God.

George
Guest
George

Just imagine the fan art!

Benj
Guest
Benj

I just googled Yoko Taro and found out that the original Nier came out in 2010!

I’ve become so used to annualised sequels being chugged out that this really took me by surprise.

GloatingSwine
Guest
GloatingSwine

Nier was not a massive commercial success, so nobody was expecting it to get a sequel at all.

Like Drakengard before it, it’s a game where the actual game part of the game is considerably less notable than the unconventional narratives and characters. (On the other hand, the soundtrack was always fantastic, and is even better in Automata. Been a good month for ear feasts, with Horizon and Nier both having cracking sound design)

Nada Namae
Guest
Nada Namae

Eh, for JRPG standards at that time Nier was really decent. Except for the bullshit sidequest collectathons which were, while intentionally so, really awful to get through. Especially the mandatory-for-the-final-ending fishing minigame.

Drakengard on the other hand is awful and boring even compared to other musou clones of that time. Only worth it for the story, which you can just catch on youtube.

InfamousDS
Guest
InfamousDS

I loved fishing in Nier Gestalt. I never had any issues with it and It was the best way to earn money, because the sandfish was by far the most valuable thing in the game which wasn’t a pain to farm.
But maybe I just really sucked, because I needed max rank weapons and was constantly replenished healing items just to make it through.

Farming was shit though. Like a month straight of just growing flowers, doing ACTUAL fucking botany and hoping RNG didn’t screw you over and not let the recessive traits pass on and make hybrid seeds.

Nada Namae
Guest
Nada Namae

Oh god, I forgot about farming. Yeah, that was way worse.

sillyskeleton
Guest
sillyskeleton

The whole annualised sequel thing is a syndrome of the stupidly successful AAA titles that print money. Nier 1, and Taro’s games in general, never fell in to that category. I think even the staunchest fans of the first never expected a second game.

cerpin
Guest
cerpin

For your Nier consumption Jimbo I would suggest Mr Clemps’ recaps on the youtube. He does a pretty good job of summarizing it all without you having to go back and play some fairly subpar gameplay.

(Without the video link in case I end up in moderation purgatory)

Horrigan
Guest
Horrigan

yoko taro is so incredibly funny to watch .. its amazing .. the way he clowns around all the time .. the fucking mask head – only in Japan XD
I just watched some stuff about nier and I ld say anyone who knows it will be quite aware of his tendency to make u play a game repeatedly to fully experience it

Django
Guest
Django

Yoko Taro is amazing. Still in playthrough 1 of Nier Automata but I love that years before MGSV’s Quiet was a thing he made he first Nier’s Kaine. A character about whom that whole ‘when you find out why she’s dressed like that you’ll regret your words and deeds’ thing could legitimately be said. F*** I loved those characters.

InfamousDS
Guest
InfamousDS

Goddamn that intro. I don’t normally listen to fan music, but I may legitimately buy Gavin’s albums now. Or at least the HZD OST.

I didn’t really care for “Hard Cash” so I haven’t looked into it before. That may change once I have money or time.

Benj
Guest
Benj

It’s kind of ironic that “Hard Cash” is the song you’re least likely to spend money on.

Christopher Hammond
Guest
Christopher Hammond

I always kind of hated ‘fan music’ until I listened to the podcast and figured it would be sensible to check out Gavin and Laura’s other stuff. He’s got some absolutely killer tracks. The metal album was bloody fantastic too, super impressive dude.

darksteel6
Guest
darksteel6

Dan Bull does really good fan music as well.

Christopher Hammond
Guest
Christopher Hammond

Cool, I’ll check it out, I don’t have much experience with the genre but Gavin’s cool so I’m open to suggestions.

InfamousDS
Guest
InfamousDS
I’ve been listening since the first episode and I have known this whole time they are both talented, but I have so little free time that the only Laura stuff I’ve engaged in is her reviews on this site (very good work if you’re lurking) and Gavin’s impromptu sing-alongs. But the HZD theme, to me, felt like the first time where he was doing what he would normally do for reals on the show and it was just… yeah. As I said, my poorness is the biggest limiter here, as I can only get on YouTube for 1 hour each… Read more »